- Home
- Queer Eye Germany
- Queer Eye Germany Season 1 Episode 5

Queer Eye Germany Season 1 Episode 5
The force is with the Fab Five as they help a Star Wars fan rediscover his self-worth and fight his way back from depression and unemployment.
Serie: Queer Eye Germany
Guest Star: Aljosha Muttardi, Ayan Yuruk, David Jakobs, Jan-Henrik Scheper-Stuke, Leni Bolt
The RVers
The new TV series dedicated to the lifestyle craze that’s sweeping the world.
Monsters Inside Me
Part horror movie, part medical detective story, find out what happens when people fall prey to an infection from a parasite, those nasty microscopic creatures found in water, soil and…
Residue
Thegovernmentcover-upofthecausesbehindamassiveexplosioninafuturisticUKmetropolisspurphotojournalistJenniferPrestonontosearchforthetruthandintheprocessblowopenaparanormalphenomenonhauntingthecity.
Married at First Sight: Second Chances
Murder by the Sea
Presented by journalist and true crime author Geoffrey Wansell, Murder by the Sea examines strange murders recorded at famous seaside resorts in the United Kingdom.
Lucky Romance
A romantic comedy about superstitious woman who tries to change her foretold fate by seducing a virgin and nerd guy. Bo Nui is a superstitious woman who relies too much…
Fish or Die
Fourdiehardfishermenaredeterminedtobethefirsttofishthemostremotewatersleftonearth.Alongtheway,theywillbattletheelements,dodgedrugcartelsandendurehell,astheyrisktheirlivesinanattempttolivetheirdream.
Land of the Lost
Rick Marshall and his children Will and Holly were on a weekend expedition rafting trough a river when an enormous earthquake diverts them to an eclectic alien world inhabited by…
Monster in My Family
A riveting new non-fiction series that delves into the world of infamous serial killers through a unique perspective rarely ever heard, as the family members of the killers come out…